Received: from nobody by stodi.digitalkingdom.org with local (Exim 4.86) (envelope-from ) id 1b1HJW-0001c3-Nx for lojban-newreal@lojban.org; Fri, 13 May 2016 10:55:50 -0700 Received: from z0gt1h.askehome.top ([66.199.238.244]:53062 helo=023a8100.askehome.top) by stodi.digitalkingdom.org with esmtp (Exim 4.86) (envelope-from ) id 1b1HJO-0001aj-Uq for lojban@lojban.org; Fri, 13 May 2016 10:55:50 -0700 Received: from 023a8100.z0gt1h.askehome.top ([127.0.0.1]:4708 helo=z0gt1h.askehome.top) by z0gt1h.askehome.top with ESMTP id 02WIJ3A81JVO00; for ; Fri, 13 May 2016 10:55:36 -0700 To: Content-Type: text/html; charset="UTF-8" Message-ID: <17083223738683617082902781541162796@z0gt1h.askehome.top> From: "Las Vegas Deals" Subject: Do Las Vegas - At Low Prices.... Content-Language: en-us MIME-Version: 1.0 Content-Transfer-Encoding: 8bit Date: Fri, 13 May 2016 10:55:36 -0700 X-Spam-Score: 2.5 (++) X-Spam_score: 2.5 X-Spam_score_int: 25 X-Spam_bar: ++ X-Spam-Report: Spam detection software, running on the system "stodi.digitalkingdom.org", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see the administrator of that system for details. Content preview: AWYQFNLDWSYNYYYKFWMKNDKTKKCWTANW Not able to explore this A-d at all? Make sure to hit this to reload'em. Do Las Vegas - At Low Prices.... [...] Content analysis details: (2.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: askehome.top] -0.0 SPF_PASS SPF: sender matches SPF record -1.0 RP_MATCHES_RCVD Envelope sender domain matches handover relay domain 1.5 LOW_PRICE BODY: Lowest Price 1.3 TRACKER_ID BODY: Incorporates a tracking ID number 0.7 MIME_HTML_ONLY BODY: Message only has text/html MIME parts -0.0 BAYES_40 BODY: Bayes spam probability is 20 to 40% [score: 0.2476] 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_REMOTE_IMAGE Message contains an external image AWYQFNLDWSYNYYYKFWMKNDKTKKCWTANW